Basic Information | |
---|---|
IMG/M Taxon OID | 3300007292 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052679 | Ga0104320 |
Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 765094712 reassembly |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 64636666 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
All Organisms → cellular organisms → Bacteria | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026592 | Metagenome / Metatranscriptome | 197 | Y |
F055775 | Metagenome | 138 | N |
F068811 | Metagenome | 124 | N |
F089054 | Metagenome | 109 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0104320_100157 | Not Available | 84834 | Open in IMG/M |
Ga0104320_100315 | Not Available | 45845 | Open in IMG/M |
Ga0104320_103541 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
Ga0104320_103705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1486 | Open in IMG/M |
Ga0104320_104050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1335 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0104320_100157 | Ga0104320_1001571 | F089054 | MLTKGKFLVSFEVPGHTKEYTEGFTEEMVIPYRTEELNPYLRYPKQQINPGHKHSTYIRLKLRDILQIPLTDITLIDIISLP* |
Ga0104320_100315 | Ga0104320_1003152 | F055775 | MAQIAQQDNLVIEVTTTAAALDGATKKKLIECIEGGTITDVILVTKEVEKKISHARVVSWLVDTTGDSPKYTIHIINADSGEVAAIALN* |
Ga0104320_103541 | Ga0104320_1035411 | F026592 | ASTQGIAALAAQGGVATLTERSDETFSVMQLFSADRE* |
Ga0104320_103705 | Ga0104320_1037051 | F026592 | TQGIAALAAQGGVATLTERSDETFSVEQFSSADRK* |
Ga0104320_104050 | Ga0104320_1040503 | F068811 | MDQDGSEHNICPNREGLCPGKEQHGASGWKKIFRHGKEPLRNKDSASQYCNKKAAVLLILNENVSETLCIFSIDKTNCCRI* |
⦗Top⦘ |