3300007279: Hydrothermal vent microbial communities from Crab Spa hydrothermal vent, East Pacific Rise - large volume pump, sample 4

Overview

Basic Information

• IMG/M Taxon OID: 3300007279
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0116042 | Gp0118652 | Ga0079919
• Sample Name: Hydrothermal vent microbial communities from Crab Spa hydrothermal vent, East Pacific Rise - large volume pump, sample 4
• Sequencing Status: Permanent Draft
• Sequencing Center: Bigelow Laboratory Single Cell Genomics Center (SCGC)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 62973825
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hydrothermal Vent Microbial Communities From Crab Spa Hydrothermal Vent, East Pacific Rise
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Fluid → Hydrothermal Vent Microbial Communities From Crab Spa Hydrothermal Vent, East Pacific Rise

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Crab Spa Hydrothermal Vent, East Pacific Rise
• Coordinates
  • Lat. (^o): 9.844167
  • Long. (^o): -104.296667
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031535	Metagenome	182	N
F056737	Metagenome	137	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0079919_1025002	Not Available	524
Ga0079919_1025707	Not Available	519

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0079919_1025002	Ga0079919_10250023	F056737	IISLSATTKGADSNSDVQLAEIALTLKRLKTAASVSVNVIVIVSAFPESSDTSIDLMTAVVALGTVYNVVALVLVKSTFLLTNVFAIMQ*
Ga0079919_1025707	Ga0079919_10257071	F031535	IIARGPKNTKAYVAMASANQLRGLTNEVNHFQVPFKTFEFYPANIE*