Basic Information | |
---|---|
IMG/M Taxon OID | 3300007108 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052638 | Ga0102731 |
Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 160421117 |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 70538577 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 2 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026592 | Metagenome / Metatranscriptome | 197 | Y |
F029444 | Metagenome | 188 | Y |
F067720 | Metagenome | 125 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0102731_100139 | All Organisms → cellular organisms → Bacteria | 56895 | Open in IMG/M |
Ga0102731_100529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 24093 | Open in IMG/M |
Ga0102731_108826 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0102731_100139 | Ga0102731_10013911 | F067720 | MSSTTYEHFVDTNKMYAAQEQFRGITKMVTKCHRFAVLGNMVRNAGQLPQPFWLGTACGGGSHSLSAGVARA* |
Ga0102731_100529 | Ga0102731_10052924 | F029444 | MDVSEQLTGFELEDLMSWTVSNLQRPFREDFSLQKSGIIAEKGLQIFGCRFVGFDRPKKRRPFSISKRALAAASETAGRGR |
Ga0102731_108826 | Ga0102731_1088263 | F026592 | NSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE* |
⦗Top⦘ |