NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007065

3300007065: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 159207311



Overview

Basic Information
IMG/M Taxon OID3300007065 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052632 | Ga0102727
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 159207311
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size44978358
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 4732
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041827Metagenome159Y
F043990Metagenome155N
F071327Metagenome122N
F071328Metagenome122N
F077404Metagenome117N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0102727_100004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 473350978Open in IMG/M
Ga0102727_100047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 47346509Open in IMG/M
Ga0102727_108402All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales873Open in IMG/M
Ga0102727_109950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium749Open in IMG/M
Ga0102727_112339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium619Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102727_100004Ga0102727_10000415F071328MEKNKSKLSNIARMAAEAFTGLICHVNKDCKMSQKHWTFTNIIRYIEDYKKNPQLIERMKWEFISEGECIVEFVKLYKHLVLERTIDPKIHQTTAIYLRYSQQLLLKKKRAIRRLGIGKKNVSAILRLCGIHYREYGDDEHRVFFLDTDVNIYFCKHYQLPIYILQRIEFSNKEYRSFILKVLPVKKSEW*
Ga0102727_100047Ga0102727_10004730F077404MNILKTTFAFFFALCFMMGANCYAQKTESIDAEASKRELKRNAIYIPPALEEYADTTLLHQRFNVENKGNYLYTPFTKDNEPSIPFNYGFLHPLDERFYNCFMGKVDRILRPKEDKGFIILTNYLVVLDDKYAFDASNKDTSKLADLKYLDFRRIKSDFSYGHPYQGFTDNDRVELSNFVQSYGRQAALETANAWVMASYPFSLQSTKFENLYTRGRKLILTDGKTTLYLYFLMIDSVALNFDTEVLPYIKGVFRFNRVR*
Ga0102727_108402Ga0102727_1084022F071327TVVVFGAFIFLLLQVHLSYKGRISEVLRKTSFFSMMLLYVQGILGVFLGIYSPEFSEVSGFSSFLKHFEYGISILLCAGMMTYVYTYIKNNKQLSLKIVVIALVAALLFEYAYPWRLIFG
Ga0102727_109950Ga0102727_1099501F041827FQYKNGNEIESVNIDGVGKSDIDYEYDTYGRIIKERRFSYNHTQNFETNITYQYDGQGRITSSHAISSKKHPACSVERKHTYTYQGNKVTVKIEIGTDNCSSPTEAAKEKTITLFVENGRVVKSLNENNQIIETIEYLNPKNTLRNMKGFPALVVEFYIRPFTYKLPFYNGIEHIEDLRFIDNIKTRDFHNGSYWEYRYSYDKRKSHDNDYLEIEEVNIYEKSHNDPTHDNYLSSASPARFYTKEK*
Ga0102727_112339Ga0102727_1123391F043990MIKKLGIIFTFGVIILEIVVYANHKIERSWIEGEFGVNMSNMNIDEKYREEEWVPNGDGEKTIILTYDQLDSSFTKSNKLPIKEDLPPNGTPEQFLNTTNGYYKYVVDENDDWNFGILIVDTARKEICIYNQIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.