NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007048

3300007048: Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', cg14ic



Overview

Basic Information
IMG/M Taxon OID3300007048 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117787 | Gp0124808 | Ga0101643
Sample NameMarine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', cg14ic
Sequencing StatusFinished
Sequencing CenterUniversity of New South Wales
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size71308945
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSeawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps
TypeHost-Associated
TaxonomyHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUpa-Upasina 'control' site, Papua New Guinea
CoordinatesLat. (o)-9.828217Long. (o)150.820517Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065740Metagenome / Metatranscriptome127N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101643_110962Not Available1138Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101643_110962Ga0101643_1109622F065740VQYKFVNYVHLVGTDHRYQNYSVNENRTYDGNSYTFLPFAVSTGAGAKGGERSSTQLAVGLNQVSVNVFAEAVQGQWQLDLKTVSLNLADDSDDVLIRSELWRIASYNMDTSRLVVTLSSPLDAAASDVPRRVLSTELVGALPTSGALVVN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.