3300007021: Human anterior nares microbial communities from NIH, USA - visit 2, subject 158924089

Overview

Basic Information

• IMG/M Taxon OID: 3300007021
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052605 | Ga0102645
• Sample Name: Human anterior nares microbial communities from NIH, USA - visit 2, subject 158924089
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 8944531
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Respiratory System → Nasopharyngeal → Anterior Nares → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089054	Metagenome	109	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0102645_100167	All Organisms → cellular organisms → Bacteria	1450

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0102645_100167	Ga0102645_1001674	F089054	MLTSGKFLVSFEVPGPLPGTTEGFCEEMNVVYRTEELNTYLRYPKQEINPGHKHSTYIRLKLREILEVNLTDITIIDIISLP*