| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006982 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117923 | Gp0125728 | Ga0102674 |
| Sample Name | Non-marine hypersaline water viral communities from A?ana, Logro?o, Spain -Vir_A?ana_Surgencia_PRE |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Alicante |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 21443807 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kirjokansivirales → Shortaselviridae → unclassified Shortaselviridae → environmental Halophage eHP-28 | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | A?ana, ?lva, Pais Vasco, Spain | |||||||
| Coordinates | Lat. (o) | 42.80111387 | Long. (o) | -2.985507 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027696 | Metagenome | 194 | N |
| F066493 | Metagenome | 126 | Y |
| F079661 | Metagenome | 115 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0102674_101795 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales | 1449 | Open in IMG/M |
| Ga0102674_103234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kirjokansivirales → Shortaselviridae → unclassified Shortaselviridae → environmental Halophage eHP-28 | 1054 | Open in IMG/M |
| Ga0102674_103669 | Not Available | 982 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0102674_101795 | Ga0102674_1017953 | F027696 | MSTTQLNTVAANLDISEHDGERVIDFDIAANTDYEIQSCVMVDENDRVVEAAVRFGRVEERPELGIGKPILASAWANMVSETTDAEAVEGDLSDFSHIVPHLRVHRENVEEYGLETLSLDEFASVVAELADLTENVLRGDDSTIENEIDAYL* |
| Ga0102674_103234 | Ga0102674_1032343 | F079661 | VSGVHDYMSDTTIQIPTDLRNRLKDERLPHESNYGDTIRRLLGDTGGQLWTEQEIRDVARKEIESFSRHRQ* |
| Ga0102674_103669 | Ga0102674_1036692 | F066493 | MTETRTREFDSGVVDVADELVQQHGPRGAIERLQQRRQTASDELAARCNEALAWIRREVIDGEGTDG* |
| ⦗Top⦘ |