NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006978

3300006978: Non-marine hypersaline water viral communities from Mallorca, Spain, 2024 - Pool_1_virus M8



Overview

Basic Information
IMG/M Taxon OID3300006978 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117927 | Gp0125737 | Ga0102686
Sample NameNon-marine hypersaline water viral communities from Mallorca, Spain, 2024 - Pool_1_virus M8
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Alicante
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6763728
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameNon-Marine Hypersaline Water Viral Communities From Mallorca, Spain, Pool 1-2-3 Virus M8 Mallorca 14
TypeHost-Associated
TaxonomyHost-Associated → Microbial → Bacteria → Unclassified → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Mallorca, Spain, Pool 1-2-3 Virus M8 Mallorca 14

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Hypersaline (saline)

Location Information
LocationSalinas de Campos (Mallorca)
CoordinatesLat. (o)39.333Long. (o)3.05Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001105Metagenome / Metatranscriptome776Y
F003767Metagenome / Metatranscriptome469Y
F078292Metagenome / Metatranscriptome116Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0102686_100009All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Faviina → Merulinidae → Orbicella → Orbicella faveolata12096Open in IMG/M
Ga0102686_100145Not Available2006Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102686_100009Ga0102686_10000913F001105MSDNKLVKTLMDAATITGLAAGIGWAAKKVVKENFTSDPSSSFMNYVKFTAVMAGSVALKQYLEDQKILPTN*
Ga0102686_100009Ga0102686_10000914F003767MASVAIMAGGAILNAAAFIGGNYLARALGGGDDAALKEKERHDKALEAYQAAYAKYSRDRTKLLDWIETNNEIKQQAKQNFTNTDYAFKLYNQAHPDKQMIPPKEPKFSDFYQPSEQQKQGELMFVGAGALALGYAAFRFL*
Ga0102686_100145Ga0102686_1001452F078292MLLAVLHRVMVHLGSLESTQEARVALGYRLGQLLRFFRALQTSRVLHNSMEHAKA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.