| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006967 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117890 | Gp0125713 | Ga0102599 |
| Sample Name | T0 (1) T34 (live) enrichments of Methanogenic microbial communities using Athabascan oil sands |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 25648119 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → oil reservoir → sand |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Canada: Alberta | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088355 | Metagenome / Metatranscriptome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0102599_111308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 508 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0102599_111308 | Ga0102599_1113081 | F088355 | LNKSLSTLGEKIMKNIKNKISVFAGQKGQLVLAILTIALFVLAAGAPNATIGVGR* |
| ⦗Top⦘ |