3300006965: T0 (3) T34 (live) enrichments of Methanogenic microbial communities using Athabascan oil sands

Overview

Basic Information

• IMG/M Taxon OID: 3300006965
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117890 | Gp0125715 | Ga0102601
• Sample Name: T0 (3) T34 (live) enrichments of Methanogenic microbial communities using Athabascan oil sands
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 24527687
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → oil reservoir → sand
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Canada: Alberta
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.65
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088355	Metagenome / Metatranscriptome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0102601_105195	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	758

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0102601_105195	Ga0102601_1051952	F088355	MKNIKNKISVFAGQKGQLVLAILTIALFVLAAGAPYATIGVGR*