NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006962

3300006962: Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st9ic



Overview

Basic Information
IMG/M Taxon OID3300006962 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117787 | Gp0124815 | Ga0101094
Sample NameMarine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st9ic
Sequencing StatusFinished
Sequencing CenterUniversity of New South Wales
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13417040
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSeawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps
TypeHost-Associated
TaxonomyHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUpa-Upasina 'control' site, Papua New Guinea
CoordinatesLat. (o)-9.828217Long. (o)150.820517Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051941Metagenome / Metatranscriptome143N
F087060Metagenome110N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101094_10030Not Available19765Open in IMG/M
Ga0101094_12689Not Available2082Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101094_10030Ga0101094_100302F051941MATSFKNMIYDLTPTTSEKTVYGVPTDSHSIINAFYVNNTDPFSSIFVEVRLDRGPNRLYVASTTSLFSVELASNQYLNLLTGPLVLEGGDKLVFTTNTTGRVQGTIAAMQVNREDQETTPIGSV*
Ga0101094_12689Ga0101094_126892F087060MTQSHTTSNDTSAKQVVRTLSGITQGKPVVTGDAPQTKKFDPVADQDNRLMQMLELSLAIKDKKSEYDDLRKSFTNDLKAALDDNEDNPKIRHSENERVHVYLSKRRVYKYSDKLTAKRLKLEAQMADLKDEEAKEVRHNKAELTKETFTVSFKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.