x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300006955
3300006955: Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Dobu 'control', cg4dc
Overview
Basic Information |
IMG/M Taxon OID | 3300006955 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117787 | Gp0124812 | Ga0101648 |
Sample Name | Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Dobu 'control', cg4dc |
Sequencing Status | Finished |
Sequencing Center | University of New South Wales |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 3899510 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
Type | Host-Associated |
Taxonomy | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information |
Location | Dobu 'control' site, Papua New Guinea |
Coordinates | Lat. (o) | -9.752083 | Long. (o) | 150.854133 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F065466 | Metagenome | 127 | Y |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0101648_10732 | Ga0101648_107321 | F065466 | MSVLLCLLSALVEVHSQTAPYVSFMGTNLPNHSYVDLTLVGSVLDGSDSVQCHTDLSTCCNSTQGADRGDWYFPNGDRLQFNGGSDDLYENREAQRVDLGCVKKCATSGIYRCDIETNAVHSDNGSDTTTWETVYAGLYASGGVCVCM |