| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006691 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0092413 | Ga0031679 |
| Sample Name | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP138 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 50044556 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Eukaryota | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PgraA7 | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | West of Cape Verde, Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 14.52 | Long. (o) | -26.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001679 | Metagenome / Metatranscriptome | 653 | Y |
| F016402 | Metagenome / Metatranscriptome | 247 | Y |
| F047706 | Metatranscriptome | 149 | Y |
| F068737 | Metatranscriptome | 124 | N |
| F092248 | Metagenome / Metatranscriptome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0031679_1006301 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| Ga0031679_1011457 | All Organisms → cellular organisms → Eukaryota | 2904 | Open in IMG/M |
| Ga0031679_1103198 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex | 563 | Open in IMG/M |
| Ga0031679_1114238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PgraA7 | 519 | Open in IMG/M |
| Ga0031679_1118573 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales | 612 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0031679_1006301 | Ga0031679_10063012 | F001679 | VWGMSWCQEAMKGVEGCEKPGEAVKRALIPGSLNDRTLNT* |
| Ga0031679_1011457 | Ga0031679_10114572 | F092248 | LLRLLLPLSDKVYLTSLIAKQFSPESLPDHSKSVGATGGVYKGQGRNRHQIMTDAY* |
| Ga0031679_1103198 | Ga0031679_11031981 | F068737 | GGMCFMMFMSGAEEKLSCIERTACEDPYLATDYLTAAKMIYKGYKLVGMHIADKYATVMNSVNDALEYGKSGAECSAKYHW* |
| Ga0031679_1114238 | Ga0031679_11142381 | F016402 | IKRLTNQGYNLQVMAANGLKEFLASERAREEAERLEFERQQKEKDRILRRIMDSNVRMMGVGFRQAYQWMEHDREKERILMLKQRGIMRRIVDKNARMVSAGYNKLIEEWKVRQNTLKEKLKFVIKALTDKDASYILAGYNGLKQRALMLSGVGMGDAAMKKIQLIKRLTNQ |
| Ga0031679_1118573 | Ga0031679_11185731 | F047706 | GYGITSDPIRDVTSDHLFAATQIAVKEPWRVIGVDQSSCQVQDCAGFLTRKMRLSATGEMVTERITISEEKGEVTYNKCDASGRPSDVERVLAIRTPLRLEFYERSARSGMRVNWTAPYSMARDTFSNIVQIAKKIKSNSSDTIGFGVASKPLSASQDSLWKAMLFAMRNPADAGLKVTNVNVRDMSGFMQRSMCIVDKPGSPT |
| ⦗Top⦘ |