| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006686 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0092396 | Ga0031662 |
| Sample Name | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP0258 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 50451721 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 4 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -3.03 | Long. (o) | -27.33 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030135 | Metagenome / Metatranscriptome | 186 | Y |
| F090441 | Metatranscriptome | 108 | N |
| F101275 | Metagenome / Metatranscriptome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0031662_1011345 | Not Available | 804 | Open in IMG/M |
| Ga0031662_1014561 | Not Available | 730 | Open in IMG/M |
| Ga0031662_1130311 | Not Available | 947 | Open in IMG/M |
| Ga0031662_1140195 | Not Available | 584 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0031662_1011345 | Ga0031662_10113451 | F030135 | EELATLSSFTDIWHSTFAGCQFPDAILPGKEAFDLVAGPLN* |
| Ga0031662_1014561 | Ga0031662_10145611 | F030135 | REELATLSSFTDIGHSTFVGCQFPDAILPGEEAIDLVAGPLN* |
| Ga0031662_1130311 | Ga0031662_11303111 | F090441 | WELATLSFLDSLALGAPITRRVIIGCQFPDAASYRKNDSDMFRPHSGT* |
| Ga0031662_1140195 | Ga0031662_11401951 | F101275 | ISDGLGGAPLFIDIEPFKYNYRIGLETLVVCTLNLWALYVKYCFFVYTLTLKCLAWGVWLQRLNLNRLAGVCLNGGACGLIR* |
| ⦗Top⦘ |