3300006634: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_10_22

Overview

Basic Information

• IMG/M Taxon OID: 3300006634
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114675 | Gp0119855 | Ga0079290
• Sample Name: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_10_22
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 37366011
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → planetary subsurface zone → oil field production water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: Ohio
• Coordinates
  • Lat. (^o): 40.178
  • Long. (^o): -81.073
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087432	Metagenome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0079290_100624	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	6830

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0079290_100624	Ga0079290_1006248	F087432	MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDRLTNLNFEQITFSAEQDARLQEISELNIPQGFQAEVREYVENGNFPEWYEHPLSDLKLKKERLQHQNDIDEAYQMILESEGLI*