| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006634 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114675 | Gp0119855 | Ga0079290 |
| Sample Name | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series 2014_10_22 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 37366011 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → planetary subsurface zone → oil field production water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Ohio | |||||||
| Coordinates | Lat. (o) | 40.178 | Long. (o) | -81.073 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087432 | Metagenome | 110 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0079290_100624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 6830 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0079290_100624 | Ga0079290_1006248 | F087432 | MIIYENGEYTPCTYRVTLQNRGVEETHYANFRTHWEDMVAKHDRLTNLNFEQITFSAEQDARLQEISELNIPQGFQAEVREYVENGNFPEWYEHPLSDLKLKKERLQHQNDIDEAYQMILESEGLI* |
| ⦗Top⦘ |