| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006612 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111355 | Gp0107629 | Ga0101558 |
| Sample Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_Marker33_DNA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 210579501 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Axial seamount, northeast pacific ocean | |||||||
| Coordinates | Lat. (o) | 45.9332 | Long. (o) | -129.982268 | Alt. (m) | N/A | Depth (m) | 1516 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F040684 | Metagenome / Metatranscriptome | 161 | N |
| F060979 | Metagenome / Metatranscriptome | 132 | Y |
| F071317 | Metagenome / Metatranscriptome | 122 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0101558_1044925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 647 | Open in IMG/M |
| Ga0101558_1120921 | Not Available | 909 | Open in IMG/M |
| Ga0101558_1346074 | Not Available | 600 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0101558_1044925 | Ga0101558_10449252 | F060979 | VTTTTEDEQLASIALGDGDGGSQPPIQDDDSGGSFLTDPGTVAAAAGVAAAVGLGLSGLGSKLLGGLLRFLGGTSFGLFLIGLFRRDKRPGPPIDFTIFTDGPLTHLEWSSPTTGGPAEKDVLEGRKDGRWGELLDFDAENTRAAV |
| Ga0101558_1120921 | Ga0101558_11209211 | F040684 | YTRRNFRLLINSNTHKEGKTMKRVIYLIILAMSLTLVFSQGKPCCKNKSGKGKVACKFNQANIDVNKDGTVIEDGTQIAAAGVQCPLSAQNTSINKKNCTNCAKSPWWKFWGKKKGCCNTNS* |
| Ga0101558_1346074 | Ga0101558_13460741 | F071317 | MLKKITAVGLITLFTGVTAAPLIHLDECNMPCCAGLATSCCDMDQEVACPTISDCGSSIFVLIVSGPFHKSELKSSDIINQRFVTDLGIPKIETNYIACLGNFDPGPIASLNLPLLI* |
| ⦗Top⦘ |