NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006612

3300006612: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_Marker33_DNA



Overview

Basic Information
IMG/M Taxon OID3300006612 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0107629 | Ga0101558
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_Marker33_DNA
Sequencing StatusPermanent Draft
Sequencing Center
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size210579501
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationAxial seamount, northeast pacific ocean
CoordinatesLat. (o)45.9332Long. (o)-129.982268Alt. (m)N/ADepth (m)1516
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040684Metagenome / Metatranscriptome161N
F060979Metagenome / Metatranscriptome132Y
F071317Metagenome / Metatranscriptome122N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101558_1044925All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium647Open in IMG/M
Ga0101558_1120921Not Available909Open in IMG/M
Ga0101558_1346074Not Available600Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101558_1044925Ga0101558_10449252F060979VTTTTEDEQLASIALGDGDGGSQPPIQDDDSGGSFLTDPGTVAAAAGVAAAVGLGLSGLGSKLLGGLLRFLGGTSFGLFLIGLFRRDKRPGPPIDFTIFTDGPLTHLEWSSPTTGGPAEKDVLEGRKDGRWGELLDFDAENTRAAV
Ga0101558_1120921Ga0101558_11209211F040684YTRRNFRLLINSNTHKEGKTMKRVIYLIILAMSLTLVFSQGKPCCKNKSGKGKVACKFNQANIDVNKDGTVIEDGTQIAAAGVQCPLSAQNTSINKKNCTNCAKSPWWKFWGKKKGCCNTNS*
Ga0101558_1346074Ga0101558_13460741F071317MLKKITAVGLITLFTGVTAAPLIHLDECNMPCCAGLATSCCDMDQEVACPTISDCGSSIFVLIVSGPFHKSELKSSDIINQRFVTDLGIPKIETNYIACLGNFDPGPIASLNLPLLI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.