| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006569 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114433 | Gp0116195 | Ga0075500 |
| Sample Name | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_RNA (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 9589387 |
| Sequencing Scaffolds | 6 |
| Novel Protein Genes | 6 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 3 |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → river → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Delaware | |||||||
| Coordinates | Lat. (o) | 39.283 | Long. (o) | -75.3633 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001679 | Metagenome / Metatranscriptome | 653 | Y |
| F030134 | Metagenome / Metatranscriptome | 186 | Y |
| F077370 | Metatranscriptome | 117 | Y |
| F081750 | Metagenome / Metatranscriptome | 114 | Y |
| F084398 | Metagenome / Metatranscriptome | 112 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0075500_102792 | Not Available | 824 | Open in IMG/M |
| Ga0075500_111079 | Not Available | 710 | Open in IMG/M |
| Ga0075500_120626 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana | 581 | Open in IMG/M |
| Ga0075500_124724 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 500 | Open in IMG/M |
| Ga0075500_128019 | Not Available | 633 | Open in IMG/M |
| Ga0075500_129092 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0075500_102792 | Ga0075500_1027921 | F030134 | KDKIQPVLQRFKLRSCNFLIVEQTNNMCGYNTYEKIIQHRGSS* |
| Ga0075500_111079 | Ga0075500_1110791 | F077370 | KKVLKQNSQQLAVPKPMSILGETINRAIDILIDIYAVNSLGSTYYSFNATPSGAPIMTVNLTDLMILQFTEYSQLAKIYGLCKMKKLQLGFTRSSNYIGGASNIITNTPSFSLQLSTIPYSSGTTTLQRAVAQADNSVEVDLQTYAPKSWDVALPPHIVSNNRANNQTFVFGSQTWVSTKLYNVENFPDLFLNLGSLAFPSFDTAAPNQGYLVGQIHGRFQLSFAGPIVQ* |
| Ga0075500_120626 | Ga0075500_1206262 | F081750 | MGQKTDARIFRQGIHKKN*ESKYIEKNNEESSLYLYKTLEIQKYLNRFFELYKIKIHNCRIFYSNGSLYVFVSFYLTAKTIYAINKDLIRYSKKFLLRAKRASSKK |
| Ga0075500_124724 | Ga0075500_1247241 | F084398 | MARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDIW |
| Ga0075500_128019 | Ga0075500_1280191 | F030134 | QRFKLRSCNFLIVEQTNNMYGYNTYEKIIQHRGSS* |
| Ga0075500_129092 | Ga0075500_1290922 | F001679 | VWRMSRRQEAMKGVEGCEKPGVAVKQAIIPGFPNYHVLNP* |
| ⦗Top⦘ |