3300006236: Marine sediment microbial communities, 0.6 km from oil contamination, elevated hydrocarbon, Gulf of Mexico? BC350

Overview

Basic Information

• IMG/M Taxon OID: 3300006236
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0116840 | Gp0121738 | Ga0082396
• Sample Name: Marine sediment microbial communities, 0.6 km from oil contamination, elevated hydrocarbon, Gulf of Mexico? BC350
• Sequencing Status: Permanent Draft
• Sequencing Center: Yale Center for Genome Analysis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 24269647
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	3

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine benthic biome → marine benthic feature → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Sediment (saline)

Location Information

• Location: Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.3
  • Long. (^o): -88.2
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030135	Metagenome / Metatranscriptome	186	Y
F056191	Metagenome / Metatranscriptome	138	Y
F082867	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0082396_116224	Not Available	601
Ga0082396_121406	Not Available	836
Ga0082396_131111	Not Available	723

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0082396_116224	Ga0082396_1162242	F056191	MICDARDRHALTAEMLEIFLSGGSMHASVKLEGIDGRAP
Ga0082396_121406	Ga0082396_1214061	F082867	MTGGRKKGSRSRRVHHINDINHNDTNITVQYIVVKPLTFSSNTLVLSVNPSLTDLSTTLATIYRQYRVTELSFTFQCSDAAGAYALAMQYVPQIGGTPSTLPTTLAEFEGPAVGYCETGRGREYTYRVPSHVLNAMGLNYYATRTGVTPIQDPDILTQGLMIFLTSTPATPIVAYMHVKFEFQTLEDPSFLAKLMHDDKEADTLVVPRAKADSLKSMTWNQL*
Ga0082396_131111	Ga0082396_1311111	F030135	ATLSSFADIWHSTFVGCQLPDAILPGREAIDLVAGPLN*