3300006199: Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t30_691M_inflammed - microbial_metagenome

Overview

Basic Information

• IMG/M Taxon OID: 3300006199
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114764 | Gp0121226 | Ga0081179
• Sample Name: Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t30_691M_inflammed - microbial_metagenome
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Texas Southwestern Medical Center
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 194636452
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: UTSWMC, Dallas, Texas, USA
• Coordinates
  • Lat. (^o): 32.73
  • Long. (^o): -96.97
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051243	Metagenome	144	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0081179_1016405	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria	1403

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0081179_1016405	Ga0081179_10164051	F051243	MGEGNGTPLQYSCLENPMDGGAWWAAVHGVAKSRTRLSDFTFTFHFHALEKEMATHSSVLAWRIPGTGEPGGLPSMGSHRVGHD*