| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006157 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116808 | Gp0121574 | Ga0082045 |
| Sample Name | Marine microbial communities from the Red Sea brine-pool Kebit Deep Lower-Interfase |
| Sequencing Status | Finished |
| Sequencing Center | King Abdullah University of Science and Technology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1490213 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Altiarchaeota → Candidatus Altiarchaeales → unclassified Candidatus Altiarchaeales → Candidatus Altiarchaeales archaeon | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From The Red Sea Brine-Pools |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Red Sea | |||||||
| Coordinates | Lat. (o) | 24.7187 | Long. (o) | 36.2888 | Alt. (m) | N/A | Depth (m) | 1469 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076704 | Metagenome | 117 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0082045_10115 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Altiarchaeota → Candidatus Altiarchaeales → unclassified Candidatus Altiarchaeales → Candidatus Altiarchaeales archaeon | 1579 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0082045_10115 | Ga0082045_101151 | F076704 | SAKNESIWNGGRDPLANSLSVDTSVDIEKISVVGRRNPVSLIEGTQELTGSLERNLYSANASYNDIIYENDTTHHELLSATGVYGGSISTCKIILNTTSNEPSADYNRVIYGVKFHSYSTSIASGETVTESVDYSATNLSTS* |
| ⦗Top⦘ |