x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300006148
3300006148: Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t14_698M_inflammed - microbial_metagenome
Overview
Basic Information |
IMG/M Taxon OID | 3300006148 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114764 | Gp0121216 | Ga0080711 |
Sample Name | Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t14_698M_inflammed - microbial_metagenome |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Texas Southwestern Medical Center |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 192988207 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information |
Location | UTSWMC, Dallas, Texas, USA |
Coordinates | Lat. (o) | 32.73 | Long. (o) | -96.97 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F047755 | Metagenome | 149 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Ga0080711_1001249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 15716 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0080711_1001249 | Ga0080711_100124913 | F047755 | MDNDKVKYLIDMINDMDIKDKLKLAICMSQSKWSGLIYNTKENFEKFDNMLKSIDEEYRTTLINFGKYKLVMFTMAKIMEMTKEEQNQTALYLFNKLIR* |