NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006133

3300006133: Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t1_693P_control - viral_metagenome



Overview

Basic Information
IMG/M Taxon OID3300006133 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114764 | Gp0121198 | Ga0080694
Sample NameIntestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t1_693P_control - viral_metagenome
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Texas Southwestern Medical Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size102242439
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameIntestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUTSWMC, Dallas, Texas, USA
CoordinatesLat. (o)32.73Long. (o)-96.97Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047755Metagenome149Y
F082888Metagenome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0080694_1000866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales11479Open in IMG/M
Ga0080694_1018898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales872Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0080694_1000866Ga0080694_100086610F082888MSQIIEVIVENKNYQLEWALSEHFEELEGKKFMLNKMAAEQIEMINNLSNTAKILLSAVAGAVIQHLIDNNCQIDNIFENGYFIVKN*FINSNCTTKNINNYSKPI*
Ga0080694_1018898Ga0080694_10188982F047755MENEKVKYLIDMINDMDIKNKLRLAICMSQSQWSSLIYNTKENFGKCKLVMFAMAKLMEIETTEQNKVALYLFNSIS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.