| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005996 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0067861 | Gp0091517 | Ga0076930 |
| Sample Name | Hypersaline microbial mat communities from Hot Lake, Washington, USA - Hot Lake Consortium UCC-RE (version 3) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 122396017 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hypersaline lake → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Hot Lake, Washington, USA | |||||||
| Coordinates | Lat. (o) | 48.972613 | Long. (o) | -119.477608 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005599 | Metagenome / Metatranscriptome | 395 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0076930_102933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5694 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0076930_102933 | Ga0076930_1029332 | F005599 | VKSEQASKVKVRMPTRLNNGEGRAGREAIDTRTCLIRRGSGHGTLER* |
| ⦗Top⦘ |