3300005792: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS908_Marker33_DNA

Overview

Basic Information

• IMG/M Taxon OID: 3300005792
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111355 | Gp0119881 | Ga0079403
• Sample Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS908_Marker33_DNA
• Sequencing Status: Permanent Draft
• Sequencing Center: Marine Biological Laboratory
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 21979386
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Axial seamount, northeast pacific ocean
• Coordinates
  • Lat. (^o): 45.9332
  • Long. (^o): -129.982268
  • Alt. (m): N/A
  • Depth (m): 1516

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037770	Metagenome	167	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0079403_106259	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon	1104

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0079403_106259	Ga0079403_1062593	F037770	KFKASRPLAFNADTIVDLPEPGMPVKQTISFTKMKLLTNSSL*