Basic Information | |
---|---|
IMG/M Taxon OID | 3300005791 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111355 | Gp0119880 | Ga0079402 |
Sample Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS907_Anemone_DNA |
Sequencing Status | Permanent Draft |
Sequencing Center | Marine Biological Laboratory |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 13538074 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Axial seamount, northeast pacific ocean | |||||||
Coordinates | Lat. (o) | 45.933231 | Long. (o) | -130.013645 | Alt. (m) | N/A | Depth (m) | 1542 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047906 | Metagenome / Metatranscriptome | 149 | N |
F050430 | Metagenome / Metatranscriptome | 145 | N |
F062154 | Metagenome / Metatranscriptome | 131 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0079402_11658 | Not Available | 1526 | Open in IMG/M |
Ga0079402_15198 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 2272 | Open in IMG/M |
Ga0079402_16012 | Not Available | 1000 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0079402_11658 | Ga0079402_116581 | F050430 | MDKKLKENIVVGIKIVGMLFFLIVLITTLVWPGGVD |
Ga0079402_15198 | Ga0079402_151982 | F062154 | VGANGVKVLSVVNARPEQPVNSVANGVKVLSVVNARLGRLVNRVVNGVRAPSVVNVRPEQAVSVDRSPVAVVVREDQVVLCGCSL* |
Ga0079402_16012 | Ga0079402_160122 | F047906 | VALAAKFTQKRTVTKERTPDAIRVPVAHGPVVGLGVLAVRWHHAVTKVRAALRLNMLVVAKRVSRVEIKFAVTAKAGLVQTQRL |
⦗Top⦘ |