NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005791

3300005791: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS907_Anemone_DNA



Overview

Basic Information
IMG/M Taxon OID3300005791 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0119880 | Ga0079402
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS907_Anemone_DNA
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size13538074
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationAxial seamount, northeast pacific ocean
CoordinatesLat. (o)45.933231Long. (o)-130.013645Alt. (m)N/ADepth (m)1542
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047906Metagenome / Metatranscriptome149N
F050430Metagenome / Metatranscriptome145N
F062154Metagenome / Metatranscriptome131N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0079402_11658Not Available1526Open in IMG/M
Ga0079402_15198All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium2272Open in IMG/M
Ga0079402_16012Not Available1000Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0079402_11658Ga0079402_116581F050430MDKKLKENIVVGIKIVGMLFFLIVLITTLVWPGGVD
Ga0079402_15198Ga0079402_151982F062154VGANGVKVLSVVNARPEQPVNSVANGVKVLSVVNARLGRLVNRVVNGVRAPSVVNVRPEQAVSVDRSPVAVVVREDQVVLCGCSL*
Ga0079402_16012Ga0079402_160122F047906VALAAKFTQKRTVTKERTPDAIRVPVAHGPVVGLGVLAVRWHHAVTKVRAALRLNMLVVAKRVSRVEIKFAVTAKAGLVQTQRL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.