3300005759: Scenedesmus quadricauda associated microbial communities from Germany - MZCH: 10104

Overview

Basic Information

• IMG/M Taxon OID: 3300005759
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114429 | Gp0111437 | Ga0078192
• Sample Name: Scenedesmus quadricauda associated microbial communities from Germany - MZCH: 10104
• Sequencing Status: Permanent Draft
• Sequencing Center: HPI Heinrich-Pette-Institut
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 168690013
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Genome Analysis Of Scenedesmus Quadricauda 10104 And Associated Bacterial Communtity
• Type: Host-Associated
• Taxonomy: Host-Associated → Algae → Green Algae → Unclassified → Unclassified → Scenedesmus Quadricauda Associated → Genome Analysis Of Scenedesmus Quadricauda 10104 And Associated Bacterial Communtity

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Germany: Hamburg
• Coordinates
  • Lat. (^o): 53.560155
  • Long. (^o): 9.859606
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093954	Metagenome / Metatranscriptome	106	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0078192_101130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia	24762

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0078192_101130	Ga0078192_10113016	F093954	MNYVPPEKPVPESIAASLARSEAQIAEGRTVPLEPVLARLRSSIARMQARPETSAPKE*