3300005684: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91805 Phage Sequencing

Overview

Basic Information

• IMG/M Taxon OID: 3300005684
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111422 | Gp0115868 | Ga0074433
• Sample Name: Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V91805 Phage Sequencing
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Queensland
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 14319711
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: St. Lucia, Queensland Australia
• Coordinates
  • Lat. (^o): -27.49999
  • Long. (^o): 153.012098
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002371	Metagenome / Metatranscriptome	566	Y
F100051	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0074433_100286	All Organisms → cellular organisms → Bacteria	2793
Ga0074433_105459	Not Available	566

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074433_100286	Ga0074433_1002863	F100051	MLERLICAVFGHRYVVERVLNHGARKVGCTRCGKHWGMHDGTRSFVPWDGELEALYAPGGILAQASGDVPPNAKVS
Ga0074433_105459	Ga0074433_1054591	F002371	SFFVMKNKQETRGGTRKKAGAKPKYNEQTKTVAFRCPMSKVDELKLIVKSKLSEWSLK*