| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005671 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111422 | Gp0115855 | Ga0074420 |
| Sample Name | Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90106 Phage Sequencing |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Queensland |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 5812671 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | St. Lucia, Queensland Australia | |||||||
| Coordinates | Lat. (o) | -27.49999 | Long. (o) | 153.012098 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002371 | Metagenome / Metatranscriptome | 566 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0074420_10752 | Not Available | 827 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0074420_10752 | Ga0074420_107522 | F002371 | MKNKQETRGGTRKKAGAKPKYNEQTKTVAFRCPMSKVDELKLIVKSKLSEWSLK* |
| ⦗Top⦘ |