3300005623: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP2 Nymph Lake 10

Overview

Basic Information

• IMG/M Taxon OID: 3300005623
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0045212 | Gp0051341 | Ga0077576
• Sample Name: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP2 Nymph Lake 10
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3818442
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → spring water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Yellowstone National Park, WY
• Coordinates
  • Lat. (^o): 44.7523206
  • Long. (^o): -110.7253926
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075084	Metagenome / Metatranscriptome	119	N
F087445	Metagenome / Metatranscriptome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0077576_10416	Not Available	672
Ga0077576_11152	Not Available	760

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0077576_10416	Ga0077576_104162	F087445	MSASPVKPGDELIQRLLNMSEYELKRVFKMIPIDKRLMLALDTIQEYQNLRSKFDNLFNAFAMNSPKVKEVMENARRTKKPIDRLADMFIDLMETMLKSKAMSLTDEDREKLREKVREMIQNEE*
Ga0077576_11152	Ga0077576_111521	F075084	PYSLGVDYARLLDFTEQNPTGKLFRRAERAMIYARRLLASWYGYDTRMLMETALRRILKKSIIYCNLVKRLGLESQYCKRYTYYDEVPCELVTEYDVEVAYADIMHMISNYNNETTSEILTNMTKECSTYEVR*