3300005570: Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser CG13 metaT (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300005570
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111384 | Gp0115575 | Ga0073993
• Sample Name: Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser CG13 metaT (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 21759362
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → aquifer → groundwater
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: Utah
• Coordinates
  • Lat. (^o): 38.9383
  • Long. (^o): -110.1342
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012917	Metagenome / Metatranscriptome	276	Y
F014836	Metagenome / Metatranscriptome	259	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0073993_138572	All Organisms → cellular organisms → Bacteria	692
Ga0073993_141794	Not Available	556

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0073993_138572	Ga0073993_1385723	F012917	LNGMILFKFLRFPLNDCGYYEKYDSIPEVNRAWDKKKHLKRKRWSQE*
Ga0073993_141794	Ga0073993_1417941	F014836	WTHKENWLQLTEPTWSHFVSISGDNTITVDQERRINELYVGPNRWDTTRLVIDEDLTIVYDDVPEISRVQGYRLPTGVVRLVIQGKGFGFVSEDILVTATEHYENDDDANIEEVEGFMYTCEDTTLTFRDAKIECNIPADHLMPYALNVQVSANGHTTEYALLSEYIK*