3300005462: Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_1000m

Overview

Basic Information

• IMG/M Taxon OID: 3300005462
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114420 | Gp0111532 | Ga0068505
• Sample Name: Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_1000m
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Hawaii
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 979766
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine aphotic zone → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Pacific Ocean
• Coordinates
  • Lat. (^o): 22.75
  • Long. (^o): -158.0
  • Alt. (m): N/A
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038276	Metagenome	166	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0068505_10374	Not Available	668

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0068505_10374	Ga0068505_103742	F038276	MNLDFLLRLTNYVNIDKQIYLAVIKQFLTVLVIINHACVLLHGNHNYKDVFYDRLGNRYIRNACDFHNLHISYNNLGLVLEKFLLYIKIINNKV*