| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005460 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114692 | Gp0115682 | Ga0073908 |
| Sample Name | Mouse cecum microbial communities from Vienna, Austria - Mucus amended microcosms incubated with D2O |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 438687249 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Mouse Cecum Microbial Communities From Vienna, Austria |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Mouse Cecum → Mouse Cecum Microbial Communities From Vienna, Austria |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Austria: Vienna | |||||||
| Coordinates | Lat. (o) | 48.2 | Long. (o) | 16.37 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013656 | Metagenome | 269 | Y |
| F059106 | Metagenome | 134 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0073908_1012466 | All Organisms → cellular organisms → Bacteria | 4374 | Open in IMG/M |
| Ga0073908_1106873 | Not Available | 639 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0073908_1012466 | Ga0073908_10124665 | F013656 | LEKRYKEPNKLELETTINVLYEENVISIYTNKPNLQKQLCKSIGEPEKEFKKGKSILASRWCIPMSEKSKISKMMLKANIFEL* |
| Ga0073908_1106873 | Ga0073908_11068732 | F059106 | MHASVWKIRVILLQTFVWIVDLKVREHLTEYLKKDIKYHRVIIGVLV* |
| ⦗Top⦘ |