Basic Information | |
---|---|
IMG/M Taxon OID | 3300005384 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056601 | Gp0051057 | Ga0074224 |
Sample Name | Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Winter |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 3492552 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → planktonic material |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Arthur Harbor, Palmer Station, Antarctic Peninsula | |||||||
Coordinates | Lat. (o) | -64.766667 | Long. (o) | -64.05 | Alt. (m) | N/A | Depth (m) | 10 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078308 | Metagenome | 116 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0074224_1054 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 39915 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0074224_1054 | Ga0074224_105414 | F078308 | MEIIVPNKIPKNIFVLIIAKMSNPFEIFFANICVTLRTIPTNIIKISIENIPVDDVMIKNQKDNPAVTARDLNLGELACILNRIDKCH* |
⦗Top⦘ |