| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005372 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056601 | Gp0051600 | Ga0074246 |
| Sample Name | Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Winter Sample 10334 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1933492 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine neritic zone → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Late winter and summer Antarctic waters | |||||||
| Coordinates | Lat. (o) | -64.067 | Long. (o) | -64.767 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004613 | Metagenome / Metatranscriptome | 431 | Y |
| F013024 | Metagenome / Metatranscriptome | 275 | N |
| F016456 | Metagenome / Metatranscriptome | 247 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0074246_103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 14893 | Open in IMG/M |
| Ga0074246_141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 44278 | Open in IMG/M |
| Ga0074246_145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 37525 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0074246_103 | Ga0074246_10317 | F016456 | MPRKPNYKDLLKKFKKRNIKNPERIATAYVKGLTAGSKKKAAKNLTGIID* |
| Ga0074246_141 | Ga0074246_14133 | F013024 | MYEIKKDKLSKDFLTKKLFWLGIIGTYIIAGVMLNKLENNADYDDLILISIIPSSYYFFMLFLSYKSFKDEAIRTTILQFTIQILLLLPLMSMYMAVLLFSTKIS* |
| Ga0074246_145 | Ga0074246_14521 | F004613 | MIPNVTKKLNLSAEDLKRQKNIISKLNLAKLPFDISPDRMCALNLEMARHSSAVLKYQEDKSGIKWIFSSIKKYKVFLIIFESNELGEEIYKEKISSKLPEYSYKTVAQIVDDGVKKNFFIKLDARAKTTKDLKIRNVRPSEEVIIEFINWKIDLLASLMKFKKDLIN* |
| ⦗Top⦘ |