3300005285: Hoatzin crop microbial communities from Cojedes, Venezuela - Epithelial fraction 14

Overview

Basic Information

• IMG/M Taxon OID: 3300005285
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0060822 | Gp0051907 | Ga0065710
• Sample Name: Hoatzin crop microbial communities from Cojedes, Venezuela - Epithelial fraction 14
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 810346924
• Sequencing Scaffolds: 0
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hoatzin Crop Microbial Communities From Cojedes, Venezuela
• Type: Host-Associated
• Taxonomy: Host-Associated → Birds → Digestive System → Crop → Lumen → Hoatzin Crop → Hoatzin Crop Microbial Communities From Cojedes, Venezuela

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: Cojedes, Venezuela
• Coordinates
  • Lat. (^o): 8.956944
  • Long. (^o): -68.299167
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004001	Metagenome	457	Y

Associated Scaffolds

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0065710_10371187	Ga0065710_103711871	F004001	VVESPSLEVFKKHVDVAIQDRFSRYGGDGLTVGLDDLRGLFQP*