NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005279

3300005279: Hoatzin crop microbial communities from Cojedes, Venezuela, sample from fiber fraction 14



Overview

Basic Information
IMG/M Taxon OID3300005279 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0060822 | Gp0051905 | Ga0065709
Sample NameHoatzin crop microbial communities from Cojedes, Venezuela, sample from fiber fraction 14
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size217972512
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHoatzin Crop Microbial Communities From Cojedes, Venezuela
TypeHost-Associated
TaxonomyHost-Associated → Birds → Digestive System → Crop → Lumen → Hoatzin Crop → Hoatzin Crop Microbial Communities From Cojedes, Venezuela

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal proximal gut

Location Information
LocationCojedes, Venezuela
CoordinatesLat. (o)8.956944Long. (o)-68.299167Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028722Metagenome / Metatranscriptome190Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0065709_1068472Not Available705Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0065709_1068472Ga0065709_10684722F028722MATVTDNGQTCLEVRGREERNEEIVRSDYNINDQYSAAHEDAISDGDPQGKGTNHGGHLHWLPDCTKPTNMIDYSNFDTSNGGGQYDIEGRNGVGGRKAAFAMSMYNPETPYGATLIDTTANIADGQYVME*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.