| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005262 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053073 | Gp0061148 | Ga0065165 |
| Sample Name | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 471862115 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | University of North Carolina, USA | |||||||
| Coordinates | Lat. (o) | 35.9082 | Long. (o) | -79.0499 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019507 | Metagenome / Metatranscriptome | 229 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0065165_1082117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0065165_1082117 | Ga0065165_10821171 | F019507 | MDARQLVDIACDEDPRAPCLWLPSDLFPEFCEAIRQKPNLIGVVIYRNKTVFDGGPYCDVTTRRP* |
| ⦗Top⦘ |