3300005212: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 Dark/N- metaT (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300005212
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0110132 | Gp0095967 | Ga0068987
• Sample Name: Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 Dark/N- metaT (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 35000295
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Cyanobacterial Communities From The Joint Genome Institute, California, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → microbial mat material
• Earth Microbiome Project Ontology (EMPO): na → na → na

Location Information

• Location: USA: California
• Coordinates
  • Lat. (^o): 37.9313884
  • Long. (^o): -122.0239394
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039839	Metagenome / Metatranscriptome	163	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0068987_148890	Not Available	508

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0068987_148890	Ga0068987_1488901	F039839	MRQTALPTRIRRMIALTRGENLARRIIPVSSRPALRRETRFGLPLTPESGGPSRHR