3300005107: Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage D2F08

Overview

Basic Information

• IMG/M Taxon OID: 3300005107
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0110122 | Gp0111702 | Ga0068702
• Sample Name: Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage D2F08
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 44587720
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa
• Type: Engineered
• Taxonomy: Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Cellulose-Adapted → Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: USA, Joint Bio-Energy Institute
• Coordinates
  • Lat. (^o): 37.8408
  • Long. (^o): -122.2896
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036417	Metagenome / Metatranscriptome	170	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0068702_100041	All Organisms → cellular organisms → Bacteria	100213

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0068702_100041	Ga0068702_10004154	F036417	LPRRRGFAICFRAMVYPARVPLRTRIPTVLVRLATDDGEVVFRARWTRSPLELQRNILFRMRRGSLLWFQDEWGHDLCFRPECVYAAMVDGR*