| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004959 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0092412 | Ga0031678 |
| Sample Name | Metatranscriptome of deep ocean microbial communities from Blanes Bay, Balearic Sea - MPBL130115 (Metagenome Metatranscriptome) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 25147215 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Blanes Bay | |||||||
| Coordinates | Lat. (o) | 41.67 | Long. (o) | 2.8 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009123 | Metagenome / Metatranscriptome | 322 | N |
| F009426 | Metagenome / Metatranscriptome | 318 | Y |
| F090441 | Metatranscriptome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0031678_108831 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 677 | Open in IMG/M |
| Ga0031678_109765 | Not Available | 602 | Open in IMG/M |
| Ga0031678_180790 | All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica | 837 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0031678_108831 | Ga0031678_1088312 | F009426 | TTAKVNKDLKLWSAMVRGETSYTIIIFMTTGPCVISAGAARETLFEGKADCCMLVCE* |
| Ga0031678_109765 | Ga0031678_1097651 | F090441 | KGEVWELATLSFLDSLALGALITRRVIIGCQFPDAASYRKNDCDTFRSHSGT* |
| Ga0031678_180790 | Ga0031678_1807901 | F009123 | SKLTMLSIVGLSATANNAEVTTSNLRSGAAFDNLKASWGKKLSLGDFSSQLDCSYDYNANRDFLKSASLSGNLVDGSGDDLSVGYEVTKNFAGDKTTEVKLTADMSGTRLTAEMDTADQLKEVSAARTVSIGDRDVDLEPSFLVKAQTARVKLMSAFGKDRASAQVDYKTEGGDISYELGYERDLQDGRQVSATLTPADKNLDVELVDTKFESGATWTAKASVPLEADNVLDAAKVTLKRAWNW* |
| ⦗Top⦘ |