3300004957: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI054_10m_RNA (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300004957
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046785 | Gp0111057 | Ga0066624
• Sample Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI054_10m_RNA (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 14231436
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → coastal inlet → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Saanich Inlet, Vancouver Island, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5
  • Alt. (m): N/A
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009123	Metagenome / Metatranscriptome	322	N
F080882	Metagenome / Metatranscriptome	114	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0066624_145213	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica	754
Ga0066624_147095	Not Available	640

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0066624_145213	Ga0066624_1452131	F009123	TSNLRSGASFDNLKASWGKALSLGDFKTQLDCSYDYNGNKEFIKDAKLSGSLIDGSGDDLSLGYEVTKNFGGDKTTEVTLTAEVSGTTVSAELDTADNLKEVGASRSVTIGDRDVTVSPSFLVKAQTARVKLMTALGKDNLSVQADIDGTDLSAIEVEYERDLEDGRTLTASLTPADKNLEVEVTDTKFESGATWTAKATVPLEGDNMVDDAKLTLTRAWSW*
Ga0066624_147095	Ga0066624_1470952	F080882	TTGSTFNSYEDVYLLGGTSHCGSWFGGLYHGRPFIGTQCNWGSSTAVGVDQTTATVALQANQTYRIQWMYNVAEGYRRAQIKVDGVVVVDSTTAYLNVDSSSTEEFLSIGSGYHTQVSETLQGSVKKVSVHICGENI*