3300004820: Chicken cecum microbial communities from Brno, Czech Republic, of chickens treated with various antibiotics - Non treated

Overview

Basic Information

• IMG/M Taxon OID: 3300004820
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114608 | Gp0114669 | Ga0071339
• Sample Name: Chicken cecum microbial communities from Brno, Czech Republic, of chickens treated with various antibiotics - Non treated
• Sequencing Status: Permanent Draft
• Sequencing Center: Masaryk University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 13322752
• Sequencing Scaffolds: 5
• Novel Protein Genes: 5
• Associated Families: 4

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae	2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes	1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Chicken Cecum Microbial Communities From Brno, Czech Republic, Of Chickens Treated With Various Antibiotics
• Type: Host-Associated
• Taxonomy: Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Brno, Czech Republic, Of Chickens Treated With Various Antibiotics

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: Brno, Czech Republic
• Coordinates
  • Lat. (^o): 49.19522
  • Long. (^o): 16.60796
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004815	Metagenome	422	Y
F005658	Metagenome	393	Y
F028669	Metagenome	190	Y
F038012	Metagenome	166	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0071339_100337	All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia	1726
Ga0071339_106169	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae	568
Ga0071339_106262	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes	564
Ga0071339_106394	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae	560
Ga0071339_107079	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae	537

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0071339_100337	Ga0071339_1003373	F028669	MYARREIKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKIERGKNCVKRG*
Ga0071339_106169	Ga0071339_1061691	F038012	MIIEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHNLLGQPVP
Ga0071339_106262	Ga0071339_1062621	F028669	MYARREIKKQRFKCWSDQFIINVNKRDGERGGRTLLRIGVMGKGRRAIEKIERGKNCVKRG*
Ga0071339_106394	Ga0071339_1063941	F004815	APSLQAFKARLDVALGSLGCWLATLHIAGGWNWVSTVVLFNPGRSRIL*
Ga0071339_107079	Ga0071339_1070791	F005658	MARVKKHHKDGLIPTPCYVQGHQPPEQAAQSHIQPGLECLQGWGIHNP