NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004641

3300004641: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI048_200m_RNA (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004641 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046785 | Gp0111056 | Ga0066623
Sample NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI048_200m_RNA (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size108229609
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal inletsea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSaanich Inlet, Vancouver Island, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)N/ADepth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003091Metagenome / Metatranscriptome508Y
F029271Metagenome / Metatranscriptome189N
F034189Metagenome / Metatranscriptome175Y
F052275Metagenome / Metatranscriptome143Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066623_1001954Not Available805Open in IMG/M
Ga0066623_1077437Not Available554Open in IMG/M
Ga0066623_1225432All Organisms → cellular organisms → Bacteria517Open in IMG/M
Ga0066623_1235510Not Available545Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066623_1001954Ga0066623_10019542F029271MSKLSDLQDIKELLDVDFRKDKFLDNQYNNSPCFNYDAAESYVANIHQFLSEKYGEAVIYNFIQEVESLRITTLKMYIESNIAAYRRFTIKTIDDSNKSYYSILTVKKGI*
Ga0066623_1077437Ga0066623_10774371F003091TKPGEGTPRQKYMSQEVFLEERYQISAGLKGPKRLDNETHEDFVLRRNAESGLLKEYLRGVWVIDGNSTALDK*
Ga0066623_1225432Ga0066623_12254322F052275SADVWDAPDRAPIATVDTRHCLGCKSLVEVPIEFHGGGLIGDSDVVPSFLNRCPDCNSSNVQSWDAKHSCPKCGEHMTASVN*
Ga0066623_1235510Ga0066623_12355101F034189MTTNLAKWASNDGQITKSGLPNDRRAKFLPSVVGFAYDLLRYEYYLGNIGLID

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.