3300004483: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 86_LOW11 (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300004483
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114290 | Gp0111210 | Ga0066546
• Sample Name: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 86_LOW11 (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 12764520
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Eukaryota	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater lake → lake sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Sediment (non-saline)

Location Information

• Location: USA: Lake Washington, Seattle, Washington
• Coordinates
  • Lat. (^o): 48.3807
  • Long. (^o): -122.1599
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037503	Metagenome / Metatranscriptome	168	Y
F046210	Metagenome / Metatranscriptome	151	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0066546_105848	All Organisms → cellular organisms → Bacteria	969
Ga0066546_117231	All Organisms → cellular organisms → Eukaryota	1383

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0066546_105848	Ga0066546_1058481	F037503	TEVELLIGLGGFTAYQTLTNSECCNISVAVRLWALRSMAEREITQIII*
Ga0066546_117231	Ga0066546_1172312	F046210	MKNLKIEAEKGFRRTLFEPELVDPNLEINFVNDAEAAVKCRNVNS*