| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004336 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110188 | Gp0091631 | Ga0066242 |
| Sample Name | Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC4C |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 37414647 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 6 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → Spongiibacter → Spongiibacter tropicus | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | mangrove biome → intertidal zone → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sao Paulo State, Brazil | |||||||
| Coordinates | Lat. (o) | -23.8553 | Long. (o) | -46.1394 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016975 | Metagenome / Metatranscriptome | 243 | Y |
| F043157 | Metagenome / Metatranscriptome | 157 | Y |
| F067247 | Metagenome / Metatranscriptome | 126 | Y |
| F094910 | Metagenome / Metatranscriptome | 105 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0066242_1000502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1284 | Open in IMG/M |
| Ga0066242_1000650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → Spongiibacter → Spongiibacter tropicus | 1176 | Open in IMG/M |
| Ga0066242_1003560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 704 | Open in IMG/M |
| Ga0066242_1008629 | Not Available | 528 | Open in IMG/M |
| Ga0066242_1009139 | Not Available | 518 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0066242_1000502 | Ga0066242_10005022 | F043157 | MGGERLMSILDERFRDCICLKIYDRTDSMRVLGELIMIKGAKSLERRIR* |
| Ga0066242_1000502 | Ga0066242_10005023 | F067247 | VRKLLSIGIVLALLVTFIVPVAVAAQDECEDPCEWTPPDCAPMPDRTTKTLAGAAMWTMLGVTDVMGKAVCATTGLLACNLGGWSDELGVIAVDVTGTAMDGVAGLLEYVFESFLGMGELGTAVGD |
| Ga0066242_1000650 | Ga0066242_10006503 | F043157 | MSILDERFRDCICLNIYDRINSMQMLGELIMTNRAKSLERR |
| Ga0066242_1003560 | Ga0066242_10035601 | F043157 | MSILDERFRNCICLSIYDRIESMRMPGELLMIKRAKSLERR |
| Ga0066242_1008629 | Ga0066242_10086291 | F016975 | MDVSSPGSQAGGATTSSVEPKASLNFSDRKALDGPAMRPETPFAVENGVGKLAAH |
| Ga0066242_1009139 | Ga0066242_10091391 | F094910 | VRKLLSIGIILALLVTFMVPVVVGAQEECENPCDYDPPECGPLPPKTTKTLAGAAVWTYLGVQDIMGRAVCATTGQMACNLGGWSDELGVIAVDVTAAMLDGVAGLAEAAIGQFLPDFAELGASVADMLRGIAGAIGGTAEE* |
| ⦗Top⦘ |