NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004237

3300004237: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 115_HOW13



Overview

Basic Information
IMG/M Taxon OID3300004237 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111141 | Ga0066477
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 115_HOW13
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size122893003
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005030Metagenome414Y
F034611Metagenome / Metatranscriptome174Y
F093312Metagenome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066477_1003565All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3631Open in IMG/M
Ga0066477_1004680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3089Open in IMG/M
Ga0066477_1012254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1683Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066477_1003565Ga0066477_10035657F005030MLVTAGFFSSGQSSTDSVYTGTLDSGKAKVVIDRETKGLNKAGLAKAIRTGTIYNSTSPYHNDLHEFTYWVAMRDFCNKALLKMRANGEVNKKRFKELKRKLSNAKAKLNASKYKGLKIEPGQYEEFLSQIDVN*
Ga0066477_1004680Ga0066477_10046804F034611MQQLNSILSLTTDLLAYGGFNHLKDDQVSNLHHLILRLKEPLTRVQENLLLTFWHNADAGILPPALVYRCNTVLQQRGLCPIGELYVEMEME*
Ga0066477_1012254Ga0066477_10122543F093312MTLKQSSVVHIQALVSADVVLPGSSSKLRLLVINLASVPGGQLVNSPTAQSLERYLQL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.