| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004237 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114290 | Gp0111141 | Ga0066477 |
| Sample Name | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 115_HOW13 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 122893003 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Lake Washington, Seattle, Washington | |||||||
| Coordinates | Lat. (o) | 48.3807 | Long. (o) | -122.1599 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005030 | Metagenome | 414 | Y |
| F034611 | Metagenome / Metatranscriptome | 174 | Y |
| F093312 | Metagenome | 106 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0066477_1003565 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3631 | Open in IMG/M |
| Ga0066477_1004680 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3089 | Open in IMG/M |
| Ga0066477_1012254 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1683 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0066477_1003565 | Ga0066477_10035657 | F005030 | MLVTAGFFSSGQSSTDSVYTGTLDSGKAKVVIDRETKGLNKAGLAKAIRTGTIYNSTSPYHNDLHEFTYWVAMRDFCNKALLKMRANGEVNKKRFKELKRKLSNAKAKLNASKYKGLKIEPGQYEEFLSQIDVN* |
| Ga0066477_1004680 | Ga0066477_10046804 | F034611 | MQQLNSILSLTTDLLAYGGFNHLKDDQVSNLHHLILRLKEPLTRVQENLLLTFWHNADAGILPPALVYRCNTVLQQRGLCPIGELYVEMEME* |
| Ga0066477_1012254 | Ga0066477_10122543 | F093312 | MTLKQSSVVHIQALVSADVVLPGSSSKLRLLVINLASVPGGQLVNSPTAQSLERYLQL* |
| ⦗Top⦘ |