Basic Information | |
---|---|
IMG/M Taxon OID | 3300004180 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114290 | Gp0111072 | Ga0066408 |
Sample Name | Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 10_HOW4 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 204994919 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum alkenivorans | 1 |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake sediment |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Lake Washington, Seattle, Washington | |||||||
Coordinates | Lat. (o) | 48.3807 | Long. (o) | -122.1599 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034190 | Metagenome / Metatranscriptome | 175 | Y |
F093898 | Metagenome / Metatranscriptome | 106 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0066408_1010331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum alkenivorans | 1449 | Open in IMG/M |
Ga0066408_1032125 | Not Available | 832 | Open in IMG/M |
Ga0066408_1040043 | Not Available | 748 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0066408_1010331 | Ga0066408_10103312 | F093898 | MMRFLLARAVNPQLSLLDGLRDWNAIAAGLREPPRRRRRYQGDNLERFLS* |
Ga0066408_1032125 | Ga0066408_10321251 | F034190 | FLGISNRIILDAFDALFDSAVVSQAVQQVKTVHSAGCGGLSDLYDLNGPELSKLIKQLDPEKGRSPLKTAAAAPTASAAQKASHSVLSRWLEQLHDHLLHKDDWEADDIEAWRAAVQDIQQNWQAETHSKPFPKLHMLKHSLQFAERHRFLGRASEAQIESFHASFNTLFHKHHLNQASNTAERLRRSLADAALRAVQPFLSVSPSAPSTSH* |
Ga0066408_1040043 | Ga0066408_10400431 | F034190 | PLLTIPPERIVPTPLHLFLGISNRIILDAFSELLGRERVEAALKAVTTVHSAGCGGKSDLYDLNGPEIRKFIKRKCSVSILAAAAASSSLPPSTTASHSILSRWLQQLHTHLLHKDDWESEEIEEWRAAVDDIWQNWRAETKQAAFPKLHMLKHSLEFAERHRFLGRASEAQIESFHASFNTLFHKQHLNQGGNTDERMRRCLADAALRAVQPFLSVSPSTPSTSF* |
⦗Top⦘ |