3300004141: Groundwater microbial communities from aquifer - Crystal Geyser CG05_land_8/20/14_0.10

Overview

Basic Information

• IMG/M Taxon OID: 3300004141
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111384 | Gp0110930 | Ga0066634
• Sample Name: Groundwater microbial communities from aquifer - Crystal Geyser CG05_land_8/20/14_0.10
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 78008875
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → aquifer → groundwater
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: USA: Utah: Grand County
• Coordinates
  • Lat. (^o): 38.9383
  • Long. (^o): -110.1342
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028669	Metagenome	190	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0066634_1003254	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus	949

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0066634_1003254	Ga0066634_10032542	F028669	MYARREIKKQRFKCWSDQFITNVNNGDGERGGRTLLRIGVMGKGRRAIEKIERGKNCVKRG*