x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300003973
3300003973: Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle
Overview
| Basic Information |
| IMG/M Taxon OID | 3300003973 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0113988 | Gp0109785 | Ga0063521 |
| Sample Name | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle |
| Sequencing Status | Permanent Draft |
| Sequencing Center | HPI Heinrich-Pette-Institut |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 218627726 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Ips Typographus Gut Microbial Communities From Hannover, Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Ips Typographus Gut → Ips Typographus Gut Microbial Communities From Hannover, Germany |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information |
| Location | Hannover, Germany |
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F005599 | Metagenome / Metatranscriptome | 395 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0063521_1002681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium fredii group → Sinorhizobium fredii | 4304 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0063521_1002681 | Ga0063521_10026815 | F005599 | MRVKPEQASKVMMWMPTCLRFGEGRVNGEAIDMGTRSIHPGIGHGTLEG* |
