| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003969 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0113966 | Gp0109823 | Ga0063589 |
| Sample Name | Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39861 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Michigan |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 61068471 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Harmful Algal Blooms In Lake Erie |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → glacial lake → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Lake Fryxell, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.611214 | Long. (o) | 163.119356 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097196 | Metagenome / Metatranscriptome | 104 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0063589_102839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2359 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0063589_102839 | Ga0063589_1028393 | F097196 | MLTMSKPPISFRLSEDELILLESNQQPGESLSLTAARLLRKQLGVVDGVVDKLETKTSNHLIQDRMDELKSDVNSYVNNRVNELLVRIEALEVKPKTTTRRSTSKVTPKDLEVQS* |
| ⦗Top⦘ |